missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PSCA Partial ORF (NP_005663, 23 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008000-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene has a nonsynonymous nucleotide polymorphism at its start codon. [provided by RefSeq]
Sequence: CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASSpecifications
| NP_005663 | |
| Liquid | |
| 8000 | |
| PSCA (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PRO232 | |
| PSCA | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.77kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS | |
| RUO | |
| PSCA | |
| Wheat Germ (in vitro) | |
| GST |