missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PROS1 Partial ORF (NP_000304, 419 a.a. - 516 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005627-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16024595

  • 3932.10 NOK / 10µg
Estimated Shipment: 26-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. [provided by RefSeq]

Sequence: GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP
Specifications

Specifications

NP_000304
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP
RUO
PROS1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5627
PROS1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PROS/PS21/PS22/PS23/PS24/PS25/PSA
PROS1
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers