missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PQBP1 Full-length ORF (AAH12358, 1 a.a. - 265 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010084-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134472

  • 6270.00 NOK / 25µg
Estimated Shipment: 25-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain (Waragai et al., 1999 [PubMed 10332029]).[supplied by OMIM]

Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
Specifications

Specifications

AAH12358
Liquid
10084
PQBP1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
RUO
PQBP1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
54.89kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MRX55/MRXS3/MRXS8/NPW38/RENS1/SHS
PQBP1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers