missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PEA15 Full-length ORF (ABM85934.1, 1 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008682-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139045

  • 4130.00 NOK / 10µg
Estimated Shipment: 06-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.[supplied by OMIM]

Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Specifications

Specifications

ABM85934.1
Liquid
8682
PEA15 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
RUO
PEA15
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
40.7kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HMAT1/HUMMAT1H/MAT1/MAT1H/PEA-15/PED
PEA15
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers