Learn More
Abnova™ Human PCGF1 Partial ORF (NP_116062, 105 a.a. - 187 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00084759-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM]
Sequence: DSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAESpecifications
NP_116062 | |
Liquid | |
84759 | |
PCGF1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
2010002K04Rik/FLJ43754/MGC10882/NSPC1/RNF3A-2/RNF68 | |
PCGF1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.87kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
DSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAE | |
RUO | |
PCGF1 | |
Wheat Germ (in vitro) | |
GST |