missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ODF2 Partial ORF (NP_002531.3, 706 a.a. - 804 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4115.00 NOK - 6245.00 NOK
Specifications
| Accession Number | NP_002531.3 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 4957 |
| Molecular Weight (g/mol) | 36.63kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16142175
|
Abnova™
H00004957-Q01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 13-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16132175
|
Abnova™
H00004957-Q01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 13-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Multiple protein isoforms are encoded by transcript variants of this gene; however, not all isoforms and variants have been fully described. [provided by RefSeq]
Sequence: KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPSpecifications
| NP_002531.3 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ44866/MGC111096/MGC9034/ODF2/1/ODF2/2/ODF84 | |
| ODF2 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 4957 | |
| ODF2 (Human) Recombinant Protein (Q01) | |
| KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP | |
| RUO | |
| ODF2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |