missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NR6A1 Partial ORF (NP_001480, 366 a.a. - 474 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002649-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135381

  • 3602.46 NOK / 10µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in vivo targets have not been identified. The gene expresses at least alternatively spliced transcript variants. [provided by RefSeq]

Sequence: RLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGK
Specifications

Specifications

NP_001480
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGK
RUO
NR6A1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2649
NR6A1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GCNF/GCNF1/NR61/RTR
NR6A1
Yes
Videos
SDS
Documents
Certificates