missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NDUFA8 Partial ORF (NP_055037.1, 1 a.a. - 72 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004702-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16014445

  • 5967.00 NOK / 25µg
Estimated Shipment: 03-02-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Sequence: MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
Specifications

Specifications

NP_055037.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
RUO
NDUFA8
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4702
NDUFA8 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CI-19KD/CI-PGIV/MGC793/PGIV
NDUFA8
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers