missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MRPL40 Partial ORF (NP_003767.2, 1 a.a. - 51 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064976-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139776

  • 3602.46 NOK / 10µg

Estimated Shipment: 13-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Deletions in this gene may contribute to the etiology of velo-cardio-facial syndrome and DiGeorge syndrome. [provided by RefSeq]

Sequence: MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLR
Specifications

Specifications

NP_003767.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.35kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLR
RUO
MRPL40
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
64976
MRPL40 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ41774/MGC9400/MRP-L22/NLVCF/URIM
MRPL40
Yes
Videos
SDS
Documents
Certificates