Learn More
Abnova™ Human LCN12 Full-length ORF (AAH41168.1, 1 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00286256-P01.25ug
Additional Details : Weight : 0.00010kg
Description
Members of the lipocalin family, such as LCN12, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to specific cells (Suzuki et al., 2004 [PubMed 15363845]).[supplied by OMIM]
Sequence: MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGNMVHLQACWAVGTGPAGMSLVDPRGAGPSVYPGSSAPACAQGSPGSWVPVLNPGSEPPPAAPGPLSWATSSHPGSPVPGHLLPPQVPCPGPPPPAPPAPGPLSRPTSSHPGSPVLGYLLPPQVPCPGPSPPSGSPVLGHLLPSPIPAHKELGLIPGGALDLSSLPWVAAPASpecifications
AAH41168.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
63.7kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC34753/MGC48935 | |
LCN12 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
286256 | |
LCN12 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGNMVHLQACWAVGTGPAGMSLVDPRGAGPSVYPGSSAPACAQGSPGSWVPVLNPGSEPPPAAPGPLSWATSSHPGSPVPGHLLPPQVPCPGPPPPAPPAPGPLSRPTSSHPGSPVLGYLLPPQVPCPGPSPPSGSPVLGHLLPSPIPAHKELGLIPGGALDLSSLPWVAAPA | |
RUO | |
LCN12 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |