Learn More
Abnova™ Human KCNE2 Partial ORF (NP_751951, 73 a.a. - 123 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4115.00 NOK - 6245.00 NOK
Specifications
Accession Number | NP_751951 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 9992 |
Molecular Weight (g/mol) | 31.35kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16181586
|
Abnova™
H00009992-Q01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 18-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16191586
|
Abnova™
H00009992-Q01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 18-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq]
Sequence: KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSPSpecifications
NP_751951 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.35kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
LQT5/LQT6/MGC138292/MIRP1 | |
KCNE2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
9992 | |
KCNE2 (Human) Recombinant Protein (Q01) | |
KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP | |
RUO | |
KCNE2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |