missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ISL2 Partial ORF (NP_665804.1, 261 a.a. - 358 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064843-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005635

  • 5078.48 NOK / 25µg


Estimated Shipment
17-11-2020
Add to basket

Description

Description

Sequence: HSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
Specifications

Specifications

NP_665804.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
RUO
ISL2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
64843
ISL2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ10160
ISL2
Yes
Videos
Documents