missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IL10 Full-length ORF (AAI04253.1, 1 a.a. - 178 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003586-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136811

  • 3602.46 NOK / 10µg

Estimated Shipment: 24-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. [provided by RefSeq]

Sequence: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Specifications

Specifications

AAI04253.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.9kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CSIF/IL-10/IL10A/MGC126450/MGC126451/TGIF
IL10
Yes
wheat germ expression system
Liquid
3586
IL10 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
RUO
IL10
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates