missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IKZF4 Partial ORF (NP_071910, 2 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064375-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139626

  • 3602.46 NOK / 10µg

Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM]

Sequence: DSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSP
Specifications

Specifications

NP_071910
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.51kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSP
RUO
IKZF4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
64375
IKZF4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EOS/KIAA1782/ZNFN1A4
IKZF4
Yes
Videos
SDS
Documents
Certificates