missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HES1 Partial ORF (NP_005515.1, 201 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003280-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16024185

  • 3932.10 NOK / 10µg
Estimated Shipment: 12-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq]

Sequence: APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Specifications

Specifications

NP_005515.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.54kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
RUO
HES1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3280
HES1 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20408/HES-1/HHL/HRY/bHLHb39
HES1
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers