missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HEL308 Partial ORF (NP_598375, 275 a.a. - 337 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00113510-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
HEL308 is a single-stranded DNA-dependent ATPase and DNA helicase (Marini and Wood, 2002 [PubMed 11751861]).[supplied by OMIM]
Sequence: GNAKAQTPIFSRSKQLKDTLLSEEINVAKKTIESSSNDLGPFYSLPSKVRDLYAQFKGIEKLYSpecifications
| NP_598375 | |
| Liquid | |
| 113510 | |
| HEL308 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC20604 | |
| HEL308 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.67kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GNAKAQTPIFSRSKQLKDTLLSEEINVAKKTIESSSNDLGPFYSLPSKVRDLYAQFKGIEKLY | |
| RUO | |
| HEL308 | |
| Wheat Germ (in vitro) | |
| GST |