missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HEL308 Partial ORF (NP_598375, 275 a.a. - 337 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00113510-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
HEL308 is a single-stranded DNA-dependent ATPase and DNA helicase (Marini and Wood, 2002 [PubMed 11751861]).[supplied by OMIM]
Sequence: GNAKAQTPIFSRSKQLKDTLLSEEINVAKKTIESSSNDLGPFYSLPSKVRDLYAQFKGIEKLYSpecifications
NP_598375 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.67kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
GNAKAQTPIFSRSKQLKDTLLSEEINVAKKTIESSSNDLGPFYSLPSKVRDLYAQFKGIEKLY | |
RUO | |
HEL308 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
113510 | |
HEL308 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC20604 | |
HEL308 | |
Recombinant | |
wheat germ expression system |