missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GULP1 Full-length ORF (AAH01103.1, 1 a.a. - 167 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00051454-P01.25ug
Additional Details : Weight : 0.00010kg
Description
The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, inflammation, and autoimmunity. CED6 is an evolutionarily conserved adaptor protein required for efficient engulfment of apoptotic cells by phagocytes.[supplied by OMIM]
Sequence: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCVSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFLSpecifications
| AAH01103.1 | |
| Liquid | |
| 51454 | |
| GULP1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCVSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL | |
| RUO | |
| GULP1 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 45.8kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CED-6/CED6/FLJ31156/GULP | |
| GULP1 | |
| Yes | |
| wheat germ expression system |