missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GBP3 Partial ORF (NP_060754, 132 a.a. - 189 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002635-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16188574

  • 3655.00 NOK / 10µg
Estimated Shipment: 28-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the guanylate-binding protein (GBP) family. GBPs specifically bind guanine nucleotides (GMP, GDP, and GTP) and contain two of the three consensus motifs found in typical GTP-binding proteins. The encoded protein interacts with a member of the germinal center kinase family. [provided by RefSeq]

Sequence: GTINQQAMDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEA
Specifications

Specifications

NP_060754
Liquid
2635
GBP3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686E0974/DKFZp686L15228/FLJ10961
GBP3
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.12kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GTINQQAMDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEA
RUO
GBP3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers