missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FOXJ1 Partial ORF (NP_001445, 341 a.a. - 421 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002302-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the forkhead family of transcription factors. Similar genes in zebrafish and mouse have been shown to regulate the transcription of genes that control the production of motile cilia. The mouse ortholog also functions in the determination of left-right asymmetry. Polymorphisms in this gene are associated with systemic lupus erythematosus and allergic rhinitis
Sequence: HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFLSpecifications
| NP_001445 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.65kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL | |
| RUO | |
| FOXJ1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 2302 | |
| FOXJ1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FKHL13/HFH-4/HFH4/MGC35202 | |
| FOXJ1 | |
| Recombinant | |
| wheat germ expression system |