missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FLOT1 Partial ORF (NP_005794.1, 126 a.a. - 225 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010211-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142136

  • 6270.00 NOK / 25µg
Estimated Shipment: 01-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined. [provided by RefSeq]

Sequence: KFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI
Specifications

Specifications

NP_005794.1
Liquid
10211
FLOT1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLOT1
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI
RUO
FLOT1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers