missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FBXW12 Partial ORF (NP_996985.1, 265 a.a. - 354 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00285231-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005825

  • 3348.63 NOK / 10µg


Estimated Shipment
19-11-2020
Add to basket

Description

Description

Sequence: LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM
Specifications

Specifications

NP_996985.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM
RUO
FBXW12
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
285231
FBXW12 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FBXO12|FBXO35|Fbw12|MGC120385|MGC120386|MGC120387
FBXW12
Yes
Videos
Documents