missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FARS2 Partial ORF (NP_006558.1, 351 a.a. - 451 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010667-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16015275

  • 5967.00 NOK / 25µg
Estimated Shipment: 03-02-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm. [provided by RefSeq]

Sequence: KVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF
Specifications

Specifications

NP_006558.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.85kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF
RUO
FARS2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10667
FARS2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FARS1/HSPC320/PheRS/dJ520B18.2
FARS2
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers