missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FAM107A Full-length ORF (NP_009108.1, 1 a.a. - 144 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human FAM107A Full-length ORF (NP_009108.1, 1 a.a. - 144 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7099135

Used for AP, Array, ELISA, WB-Re

4115.00 NOK - 6245.00 NOK

Specifications

Accession Number	NP_009108.1
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	11170
Molecular Weight (g/mol)	43.9kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16126312 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00011170-P01.25UG	25 ug	6245.00 NOK 25µg View alternative products Save Up to »	Estimated Shipment: 14-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16116312 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00011170-P01.10UG	10 ug	4115.00 NOK 10µg View alternative products Save Up to »	Estimated Shipment: 14-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL

Specifications

Accession Number	NP_009108.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	43.9kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Immunogen	MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
Regulatory Status	RUO
Common Name	FAM107A
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	11170
Name	FAM107A (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	DRR1/FLJ30158/FLJ45473/TU3A
Gene Symbol	FAM107A
Recombinant	Recombinant
Expression System	wheat germ expression system

Abnova™ Human FAM107A Full-length ORF (NP_009108.1, 1 a.a. - 144 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents