missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CUL7 Partial ORF (AAH33647, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009820-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141326

  • 5540.00 NOK / 25µg
Estimated Shipment: 23-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG
Specifications

Specifications

AAH33647
Liquid
9820
CUL7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0076/dJ20C7.5
CUL7
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG
RUO
CUL7
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers