missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BNIP1 Full-length ORF (AAH10959, 1 a.a. - 228 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000662-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142321

  • 6270.00 NOK / 25µg
Estimated Shipment: 25-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq]

Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
Specifications

Specifications

AAH10959
Liquid
662
Human BNIP1 Full-length ORF (AAH10959, 1 a.a. - 228 a.a.) Recombinant Protein with GST-tag at N-terminal
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
NIP1, SEC20, TRG-8
BNIP1
Yes
wheat germ expression system
AP, Array, ELISA, WB-Re
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
50.82kDa
Glutathione Sepharose 4 Fast Flow
25μg
RUO
BNIP1
Wheat Germ (in vitro)
GST Tag
Videos
SDS
Documents
Certificates
Special Offers

Special Offers