missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AXIN2 Partial ORF (NP_004646, 745 a.a. - 843 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008313-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16004995

  • 5078.48 NOK / 25µg


Estimated Shipment
24-11-2020
Add to basket

Description

Description

Sequence: EDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID
Specifications

Specifications

NP_004646
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID
RUO
AXIN2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8313
AXIN2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AXIL|DKFZp781B0869|MGC10366|MGC126582
AXIN2
Yes
Videos
SDS
Documents