missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATP7B Partial ORF (NP_000044, 1372 a.a. - 1465 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000540-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142091

  • 3602.46 NOK / 10µg

Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). [provided by RefSeq]

Sequence: QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Specifications

Specifications

NP_000044
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.08kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
RUO
ATP7B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
540
ATP7B (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PWD/WC1/WD/WND
ATP7B
Yes
Videos
SDS
Documents
Certificates