missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARX Partial ORF (NP_620689, 159 a.a. - 264 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00170302-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005815

  • 3348.63 NOK / 10µg


Estimated Shipment
23-11-2020
Add to basket

Description

Description

Sequence: LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPR
Specifications

Specifications

NP_620689
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue
LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPR
RUO
ARX
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
170302
ARX (Human) Recombinant Protein
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ISSX|MRX29|MRX32|MRX33|MRX36|MRX38|MRX43|MRX54|MRX76|MRX87|MRXS1|PRTS
ARX
Yes
Videos
SDS
Documents