missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AKR1D1 Full-length ORF (NP_005980.1, 1 a.a. - 326 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006718-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16140972

  • 3602.46 NOK / 10µg

Estimated Shipment: 29-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. [provided by RefSeq]

Sequence: MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Specifications

Specifications

NP_005980.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
63.8kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
AKR1D1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6718
AKR1D1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
3o5bred/SRD5B1
AKR1D1
Yes
Videos
SDS
Documents
Certificates