missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ACSS2 Partial ORF (NP_061147.1, 32 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00055902-Q01.25ug

Detalles adicionales : Weight : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16015585

  • 5967.00 NOK / 25µg
Estimated Shipment: 04-01-2022

Please to purchase this item. Need a web account? Register with us today!


Descripción

Descripción

This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP
Especificaciones

Especificaciones

NP_061147.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP
RUO
ACSS2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
55902
ACSS2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACAS2/ACS/ACSA/AceCS/DKFZp762G026/dJ1161H23.1
ACSS2
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales