missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ABI3 Partial ORF (NP_057512.1, 75 a.a. - 182 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051225-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136736

  • 5420.23 NOK / 25µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain, and are components of the Abi/WAVE complex which regulates Rac-dependent actin polymerization. The encoded protein inhibits ectopic metastasis of tumor cells as well as cell migration. This may be accomplished through interaction with p21-activated kinase. [provided by RefSeq]

Sequence: MLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATL
Specifications

Specifications

NP_057512.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATL
RUO
ABI3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51225
ABI3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NESH/SSH3BP3
ABI3
Yes
Videos
SDS
Documents
Certificates