missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FPGT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09412-100UL
This item is not returnable.
View return policy
Description
FPGT Polyclonal specifically detects FPGT in Human samples. It is validated for Western Blot.Specifications
FPGT | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
fucose-1-phosphate guanyltransferase, fucose-1-phosphate guanylyltransferase, GDP-beta-L-fucose pyrophosphorylase, GDP-L-fucose diphosphorylase, GDP-L-fucose pyrophosphorylase, GFPPEC 2.7.7.30 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FPGT (NP_003829). Peptide sequence TSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIP | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
8790 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |