missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FKBP5 (Human) Recombinant Protein

Human FKBP5 full-length ORF ( AAH42605, 1 a.a. - 457 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002289-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16195021

  • 5540.00 NOK / 25µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Specifications

Specifications

AAH42605
FK506 binding protein 5
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FKBP5
GST
2289
Wheat germ expression system
25 μg
FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers