missing translation for 'onlineSavingsMsg'
Learn More

DYSFIP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17243-25UL

Product Code. 18329436

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DYSFIP1 Polyclonal antibody specifically detects DYSFIP1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	DYSFIP1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	dysferlin interacting protein 1, dysferlin interacting protein 1 (toonin), dysferlin-interacting protein 1, dysferlin-interacting protein 1 (toonin), MGC138299, toonin
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: YLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	116729
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description