missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DAP (Human) Recombinant Protein

Human DAP full-length ORF ( AAH02726, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001611-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193891

  • 5540.00 NOK / 25µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Specifications

Specifications

AAH02726
death-associated protein
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DAP
GST
1611
Wheat germ expression system
25 μg
MGC99796
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers