missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CETN2 (Human) Recombinant Protein

Human CETN2 full-length ORF ( AAH05334, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001069-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193121

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Specifications

Specifications

AAH05334
centrin, EF-hand protein, 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CETN2
GST
1069
Wheat germ expression system
10 μg
CALT, CEN2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers