missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BLVRA (Human) Recombinant Protein

Human BLVRA full-length ORF ( AAH08456, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000644-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142261

  • 4130.00 NOK / 10µg
Estimated Shipment: 01-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Specifications

Specifications

AAH08456
biliverdin reductase A
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BLVRA
GST
644
Wheat germ expression system
10 μg
BLVR, BVR, BVRA
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers