missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ARF3 (Human) Recombinant Protein

Human ARF3 full-length ORF ( AAH07762, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

4115.00 NOK - 6245.00 NOK

Accession Number	AAH07762
Gene ID (Entrez)	377
Name	ADP-ribosylation factor 3
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16131791 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000377-P01.10UG	10 μg	4115.00 NOK 10µg View alternative products Save Up to »	Estimated Shipment: 17-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16141791 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000377-P01.25UG	25 μg	6245.00 NOK 25µg View alternative products Save Up to »	Estimated Shipment: 17-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK

Specifications

Accession Number	AAH07762
Name	ADP-ribosylation factor 3
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Symbol	ARF3
Protein Tag	GST

Gene ID (Entrez)	377
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description