missing translation for 'onlineSavingsMsg'
Learn More

USP18 Antibody [HRP], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-35697H

Product Code. 30500658

6175.00 NOK / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

USP18 Polyclonal antibody specifically detects USP18 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	USP18
Classification	Polyclonal
Formulation	PBS
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody
Isotype	IgG

Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Conjugate	HRP
Gene Alias	EC 3.1.2.15, EC 3.4.19.-, hUBP43, ISG15-specific-processing protease, ISG43UBP43, ubiquitin specific peptidase 18, ubiquitin specific protease 18, ubl carboxyl-terminal hydrolase 18, ubl thioesterase 18,43 kDa ISG15-specific protease, Ubl thiolesterase 18
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP18 (NP_059110.2).,, Sequence:, DVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
Quantity	0.1 mL
Research Discipline	Cell Biology, Neuroscience, Ubiquitin Proteasome Pathway
Gene ID (Entrez)	11274
Content And Storage	Store at 4°C in the dark.
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

USP18 Antibody [HRP], Novus Biologicals Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions