missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SGLT1/SLC5A1 Antibody [PE], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35198PE
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
SGLT1/SLC5A1 Polyclonal antibody specifically detects SGLT1/SLC5A1 in Human samples. It is validated for ELISA,Western Blot
Spezifikation
| SGLT1/SLC5A1 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| PE | |
| D22S675, High affinity sodium-glucose cotransporter, Na+/glucose cotransporter 1, NAGTsodium/glucose cotransporter 1, SGLT1Na(+)/glucose cotransporter 1, solute carrier family 5 (sodium/glucose cotransporter), member 1, Solute carrier family 5 member 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-500 of human SGLT1/SLC5A1 (NP_000334.1).,, Sequence:, ECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG | |
| 0.1 mL | |
| Membrane Trafficking and Chaperones | |
| 6523 | |
| Store at 4°C in the dark. | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur