missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CROT Antibody [DyLight 550], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38113R
This item is not returnable.
View return policy
Description
CROT Polyclonal antibody specifically detects CROT in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot
Specifications
| CROT | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 54677 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Immunoprecipitation, Western Blot | |
| DyLight 550 | |
| carnitine O-octanoyltransferase, COTperoxisomal carnitine O-octanoyltransferase, EC 2.3.1, EC 2.3.1.137, peroxisomal carnitine acyltransferase, peroxisomal carnitine octanoyltransferase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1).,, Sequence:, MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction