missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Human Coronavirus Spike S1 Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37887JF669
This item is not returnable.
View return policy
Description
Human Coronavirus Spike S1 Polyclonal antibody specifically detects Human Coronavirus Spike S1 in HCoV-229E samples. It is validated for ELISA,Western Blot
Specifications
| Human Coronavirus Spike S1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| A synthetic peptide corresponding to a sequence within amino acids 1074-1173 of coronavirus Spike S1 (NP_073551.1).,, Sequence:, TGRGDCKGFSSDVLSDVIRYNLNFEENLRRGTILFKTSYGVVVFYCTNNTLVSGDAHIPFGTVLGNFYCFVNTTIGNETTSAFVGALPKTVREFVISRTGH | |
| 0.1 mL | |
| Primary | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| Janelia Fluor 669 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| HCoV-229E | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction