missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PICK1 Antibody [Allophycocyanin], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35510APC
This item is not returnable.
View return policy
Description
PICK1 Polyclonal antibody specifically detects PICK1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| PICK1 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| APC | |
| alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PICK1 (NP_036539.1).,, Sequence:, YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI | |
| 0.1 mL | |
| Signal Transduction, Transcription Factors and Regulators, Vision | |
| 9463 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction