missing translation for 'onlineSavingsMsg'
Learn More
Learn More
E2F8 Antibody [Alexa Fluor« 594], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35168AF594
This item is not returnable.
View return policy
Description
E2F8 Polyclonal antibody specifically detects E2F8 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| E2F8 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| Alexa Fluor 594 | |
| E2F family member 8, E2F transcription factor 8, E2F-8, FLJ23311, transcription factor E2F8 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 788-867 of human E2F8 (NP_078956.2).,, Sequence:, PVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 79733 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction