missing translation for 'onlineSavingsMsg'
Learn More

PKC beta Antibody [DyLight 550], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-35369R

Product Code. 30500340

6175.00 NOK / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PKC beta Polyclonal antibody specifically detects PKC beta in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	PKC beta
Classification	Polyclonal
Formulation	50mM Sodium Borate
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody
Isotype	IgG

Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Conjugate	DyLight 550
Gene Alias	EC 2.7.11, EC 2.7.11.13, MGC41878, PKC-B, PKC-beta, PKCBPRKCB2, PRKCB1protein kinase C beta 1, protein kinase C beta type, protein kinase C, beta, protein kinase C, beta 1, protein kinase C, beta 1 polypeptide
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human PKC beta (NP_997700.1).,, Sequence:, SFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLT
Quantity	0.1 mL
Research Discipline	Cancer, mTOR Pathway, Phospho Specific, Protein Kinase, Signal Transduction, Wnt Signaling Pathway
Gene ID (Entrez)	5579
Content And Storage	Store at 4°C in the dark.
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

PKC beta Antibody [DyLight 550], Novus Biologicals Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions