missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Isoleucyl tRNA synthetase Antibody [DyLight 594], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35104DL594
This item is not returnable.
View return policy
Beschreibung
Isoleucyl tRNA synthetase Polyclonal antibody specifically detects Isoleucyl tRNA synthetase in Human samples. It is validated for ELISA,Western Blot
Spezifikation
| Isoleucyl tRNA synthetase | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| DyLight 594 | |
| EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human Isoleucyl tRNA synthetase (NP_002152.2).,, Sequence:, SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 3376 | |
| Store at 4°C in the dark. | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur