missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SF2 Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35675JF669
This item is not returnable.
View return policy
Description
SF2 Polyclonal antibody specifically detects SF2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| SF2 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| Janelia Fluor 669 | |
| Alternative-splicing factor 1, ASFpre-mRNA-splicing factor SF2, P33 subunit, MGC5228, serine/arginine-rich splicing factor 1, SF2FLJ53078, SF2p33, SFRS1splicing factor 2, Splicing factor, arginine/serine-rich 1ASF-1, SR splicing factor 1, SRp30a | |
| A synthetic peptide corresponding to a sequence within amino acids 1-248 of human SF2 (NP_008855.1).,, Sequence:, GGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSP | |
| 0.1 mL | |
| DNA replication Transcription Translation and Splicing | |
| 6426 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction