missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFS5 Antibody [DyLight 755], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37943IR
This item is not returnable.
View return policy
Description
NDUFS5 Polyclonal antibody specifically detects NDUFS5 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| NDUFS5 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| DyLight 755 | |
| CI-15 kDa, CI-15k, CI15K, Complex I-15 kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 5 (15kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 5, NADH:ubiquinone oxidoreductase 15 kDa IP subunit, NADH-ubiquinone oxidoreductase 15 kDa subunit | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1).,, Sequence:, MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP | |
| 0.1 mL | |
| Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 4725 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction