missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HNF1 Antibody [PE], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38029PE
This item is not returnable.
View return policy
Description
HNF1 Polyclonal antibody specifically detects HNF1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| HNF1 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| PE | |
| HNF1 homeobox A, IDDM20, LFB1transcription factor 1, hepatic; LF-B1, hepatic nuclear factor (HNF1), albuminproximal factor, MODY3, TCF1hepatic, Transcription factor 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human HNF1 (NP_000536.6).,, Sequence:, GEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNI | |
| 0.1 mL | |
| Transcription Factors and Regulators | |
| 6927 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction