missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLF1 Antibody [Allophycocyanin], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35154APC
This item is not returnable.
View return policy
Description
KLF1 Polyclonal antibody specifically detects KLF1 in Rat samples. It is validated for ELISA,Western Blot
Specifications
| KLF1 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| APC | |
| EKLFerythroid-specific transcription factor EKLF, Erythroid krueppel-like transcription factor, erythroid Kruppel-like factor, HBFQTL6, INLU, Krueppel-like factor 1, Kruppel-like factor 1 (erythroid), monoclonal A3D8 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF1 (NP_006554.1).,, Sequence:, MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSE | |
| 0.1 mL | |
| Cancer | |
| 10661 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction